DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG16710

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:336 Identity:88/336 - (26%)
Similarity:128/336 - (38%) Gaps:81/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGLVLCQGLAQLL--------------DKKC-HDPKTSENI--------NFNH------------ 39
            |.|..|..|...|              |:.| :.||..|.:        |..|            
  Fly    37 ISLARCTSLLPFLKPHNMTPAEKAVFEDRYCGYGPKGQELLDRVLICCPNMGHILPNTQICGPIM 101

  Fly    40 ------GATET----APWMASIYK--------NNQFI--CDGTLVHKLFVLTAASC--ISKDSQL 82
                  |..||    .||||.|..        |.:.:  |.|:|:...:|||||.|  |:.....
  Fly   102 PAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLR 166

  Fly    83 YVLFGMYN--QYRDASQFFNNEQY--------GVAVALQHSNF-----RPNNGVNDIGLLRLYGE 132
            .|..|.:|  ...|.....|..::        .|.::::|.::     ||   .|||.||||...
  Fly   167 RVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERP---YNDIALLRLKFP 228

  Fly   133 VTHYAHIRPICIILDHVVKSAPF--ERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLL 195
            |.:.|.|:|||:.||::..:..|  .:.:..||.....:..|.|....|::.:...||..:...|
  Fly   229 VRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSL 293

  Fly   196 PIN-EGQFCAGN-RDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCS-PTSVYTDVVAF 257
            .:: |...|||| .....|:.:||.||.|....|.:......|:.|||...|. ..:.||....|
  Fly   294 GLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSKF 358

  Fly   258 KDWI-YNTVRN 267
            .:|| :|...|
  Fly   359 VEWILWNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 71/250 (28%)
Tryp_SPc 46..261 CDD:214473 69/246 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG16710NP_651167.3 CLIP 35..84 CDD:288855 10/46 (22%)
Tryp_SPc 105..362 CDD:214473 72/259 (28%)
Tryp_SPc 106..362 CDD:238113 72/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.