DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG31219

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:255 Identity:74/255 - (29%)
Similarity:108/255 - (42%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMAS-IYKNNQFI-----CDGTLVHKLFVLTAASCIS---KDSQL-YVLFG--------MYN-- 90
            ||||. :|.|...:     |.|:|::..:|||:|.|::   :|..| .|..|        .||  
  Fly   101 PWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPD 165

  Fly    91 -QYRDASQFFNNEQYGVAVALQHSNFRPNNGVN---DIGLLRLYGEVTHYAHIRPICIILDHVVK 151
             :.:|......|.:..:...:.|..|...:..|   ||.||||...|.:...|.||||     .|
  Fly   166 CRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI-----PK 225

  Fly   152 SAPF--ERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEG-QFCAGNRDR-SFC 212
            ...|  .:.|..||.:......|||....::.::....|......|.:|:. |.|||..|. ..|
  Fly   226 HGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTC 290

  Fly   213 RSNSGSPL--TADFTYGVKNITVQV-GLVSYGSELCSP---TSVYTDVVAFKDWIYNTVR 266
            :.:||.||  |.|      |.:|.: |:.:|||:.|..   ..:||...||..||...:|
  Fly   291 QGDSGGPLMVTMD------NSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 73/251 (29%)
Tryp_SPc 46..261 CDD:214473 71/248 (29%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 71/248 (29%)
Tryp_SPc 90..342 CDD:238113 73/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.