DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG5255

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:295 Identity:73/295 - (24%)
Similarity:124/295 - (42%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVL--CQGLAQLLDKKCHDPKTSEN--INFNHGATETAPWMASI--YKNNQFICDGTLVH 65
            |.|:.|||  ....:|:|    :.|:.::|  :.....|...||:..|:  ..:....|.|.::.
  Fly     3 LILLPLVLFTSSAASQIL----YPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIID 63

  Fly    66 KLFVLTAASCI--SKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLR 128
            :.:::|||.|.  .:.:...||.|..:.:::.|:::..::     .::|||:.|....|||.||.
  Fly    64 ERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDR-----IVEHSNYAPRKYRNDIALLH 123

  Fly   129 LYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGT-------EASSQVRQTVYLSQKKPF 186
            |...:......:|  :.|||.. ..|..|....||   ||       .|..|..:..|:    ||
  Fly   124 LNESIVFDNATQP--VELDHEA-LVPGSRLLLTGW---GTLSLGGDVPARLQSLEVNYV----PF 178

  Fly   187 E----CHRNGQLLPINEGQFCAGN-RDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCS 246
            |    .|.|...:.|  |..|..| :.|..|..:||.||       |.|..: |.||::|.. |:
  Fly   179 EQCRAAHDNSTRVDI--GHVCTFNDKGRGACHGDSGGPL-------VHNGKL-VALVNWGLP-CA 232

  Fly   247 P--TSVYTDVVAFKDWIYNTVRNFETKGDQVVYEE 279
            .  ...:..:..:.|:|...:...:|...:.:.||
  Fly   233 KGYPDAHASISYYHDFIRTHLSLSKTDSSEDIEEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 59/235 (25%)
Tryp_SPc 46..261 CDD:214473 58/232 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 60/245 (24%)
Tryp_SPc 30..252 CDD:238113 61/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.