DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG5246

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:283 Identity:68/283 - (24%)
Similarity:115/283 - (40%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATET------------APWMASIYKN-NQFI 58
            |.||.:::..........|.| .:...|.:..|...||            ||:..||... .:.:
  Fly     4 LVLISVLVILSQCSAKSVKIH-RRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHV 67

  Fly    59 CDGTLVHKLFVLTAASCISKDSQ-LYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVN 122
            |.|:::...::||||.|:....| |.::.|..:..|..:::..:   |..:...|.  :|... |
  Fly    68 CGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVD---GSKIHCSHD--KPAYH-N 126

  Fly   123 DIGLLR-----LYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGT--EASSQVRQTVYL 180
            ||.|:.     :|.::|     :||.:.....:.... ::....||....|  ..|:|: |.:.|
  Fly   127 DIALIHTAKPIVYDDLT-----QPIKLASKGSLPKVG-DKLTLTGWGSTKTWGRYSTQL-QKIDL 184

  Fly   181 SQKKPFECH---RNGQLLPINEGQFCAGNRD-RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYG 241
            :......|.   ||...|  :||..|...:: ...|..:||.||..      .|.|: ||:|::|
  Fly   185 NYIDHDNCQSRVRNANWL--SEGHVCTFTQEGEGSCHGDSGGPLVD------ANQTL-VGVVNWG 240

  Fly   242 SELCS---PTSVYTDVVAFKDWI 261
             |.|:   | .|:..|..:.|||
  Fly   241 -EACAIGYP-DVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/232 (25%)
Tryp_SPc 46..261 CDD:214473 56/230 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 57/243 (23%)
Tryp_SPc 42..263 CDD:238113 59/244 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.