DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG4053

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:112/285 - (39%) Gaps:60/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLAQLLD----KKCHDPKTSEN--INFNHGATETAPWMAS---IYKNNQFICDGT 62
            |:||.|:|   |...:|    |:..:.|..:|  :.........||:..|   |:|.:  ||.|.
  Fly     5 LSLIWLLL---LGTSIDVTRGKRLDNRKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTH--ICSGV 64

  Fly    63 LVHKLFVLTAASCISKDS--QLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFR-PNNGVNDI 124
            ::::.::|||..|....|  .|.::.|..::.......|.:|      ||.|..:. |....|||
  Fly    65 ILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDE------ALVHCLYDIPYVYNNDI 123

  Fly   125 GLLRLYGEVTHYAHIRPICIILD--HVVKSAPFERFEG-----FGWQQQGTEASS----QVRQTV 178
            .|:          |:....|..|  .:|:.:..:...|     .||   |...||    |..||:
  Fly   124 ALI----------HVNESIIFNDRTQIVELSREQPPAGSTVTLTGW---GAPESSYPTVQYLQTL 175

  Fly   179 YLSQKKPFECHRNGQLLP-INEGQFCAGNRD-RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYG 241
            .|:.....||........ |:.|..|...|: ...|..:||.||..:...        ||||::|
  Fly   176 NLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKL--------VGLVNWG 232

  Fly   242 SELC--SPTSVYTDVVAFKDWIYNT 264
             ..|  ....:|.:.|.::|||..|
  Fly   233 -RACGVGMPDMYANTVYYQDWIRRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/238 (25%)
Tryp_SPc 46..261 CDD:214473 58/235 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 59/248 (24%)
Tryp_SPc 35..256 CDD:238113 61/250 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.