DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG31326

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:107/250 - (42%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQ-----FICDGTLVHKLFVLTAASCI---SKD---SQLYVLFGMYNQYRDASQFF 99
            ||:.:|::..:     |||.|||:....||:||.|.   .:|   |:|.|..|     |:.....
  Fly   286 PWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG-----RNTLAIH 345

  Fly   100 NNEQY-GVAVALQHSNFRPNNGVN-DIGLLRLYGEVTHYAHIRPICI-------ILDHVVKSAPF 155
            ::.:: ||:..:.|.||:...... |:.|:||...|.:..:|.|||:       .|...:||   
  Fly   346 SDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKS--- 407

  Fly   156 ERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPL 220
             ...|:|..:.|| .:::|.:...|:......|......:.:.....||.......|.|:.|.||
  Fly   408 -YVAGWGPDETGT-GNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGAGPCASDGGGPL 470

  Fly   221 TADFTYGVKNITVQVGLVSYG--------SELCSPTSVYTDVVAFKDWIYNTVRN 267
                ....:::.|..|::|.|        .||..| ||:|||....:|:...:.|
  Fly   471 ----MLREQDVWVLRGVISGGVINEKENTCELSKP-SVFTDVAKHIEWVRQKMWN 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 64/245 (26%)
Tryp_SPc 46..261 CDD:214473 63/242 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/245 (26%)
Tryp_SPc 277..514 CDD:214473 63/242 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.