DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG9649

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:115/265 - (43%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FNHGATET----APWMASIY----KNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYN--- 90
            |.|...|.    .||||:::    ::..|:|.|||:....|::||.|..        ||..|   
  Fly   256 FIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFR--------FGSRNLPG 312

  Fly    91 ------QYRDASQFFNN-EQYGVAVALQHSNFRPNNGVN-DIGLLRLYGEVTHYAHIRPICIILD 147
                  ..|::...|:: ...|||..|.|..:.||...: |:.||:|...|....:|:|||:..:
  Fly   313 ERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNE 377

  Fly   148 HVVKSAPF---ERFEGFGWQQQGTEAS--SQVRQTVYLSQKKPFECHRNGQLLPINEGQF----- 202
            :.:...|.   ....|:|..::|...:  :::..|..::|   :||..|   |.....:|     
  Fly   378 NFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQ---WECRGN---LSEENAKFITSHT 436

  Fly   203 -CAGNRDRSF-CRSNSGSPLTADFTYGVKNITVQVGLVSYGSEL---CSPT--SVYTDVVAFKDW 260
             ||.|...|. |..:||..|...    .::|.:..|:||.|..:   |:.|  .:||||....:|
  Fly   437 ICASNAQASGPCSGDSGGGLMLQ----EQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEW 497

  Fly   261 IYNTV 265
            :.:::
  Fly   498 LLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/249 (26%)
Tryp_SPc 46..261 CDD:214473 64/246 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 66/258 (26%)
Tryp_SPc 259..497 CDD:214473 65/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.