DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG11670

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:287 Identity:73/287 - (25%)
Similarity:125/287 - (43%) Gaps:76/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KTSE----NINFNHGATETA----PWMASIYKNNQ-----FICDGTLVHKLFVLTAASCIS---- 77
            ||:|    :.:|| |.:..|    |.||::...|:     :.|.|:|:.:.||||||.|::    
  Fly   159 KTAETEDLHDDFN-GRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGT 222

  Fly    78 ------------KDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLY 130
                        |:.:|.|.    .|.|..:|.:.:..|..::     |:      :||||::|.
  Fly   223 SPDIVKIGDIKLKEWELNVA----PQRRRVAQIYLHPLYNASL-----NY------HDIGLIQLN 272

  Fly   131 GEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQG-TEASSQVRQTVYLSQKKPFECHRNGQL 194
            ..|.:...:||:.:   ..:...|:.:....|:...| .:..:.:...:.||.....:|:.:   
  Fly   273 RPVEYTWFVRPVRL---WPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSS--- 331

  Fly   195 LPINEG--------QFCAGN--RDRSFCRSNSGSPLTADFTYGVKNITVQ-------VGLVSYG- 241
            ||.:||        |.||.:  ::|..|:.:||.||..:.....:..|.:       ||:.||| 
  Fly   332 LPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGA 396

  Fly   242 ---SELCSPTSVYTDVVAFKDWIYNTV 265
               |||   ..|||.|.::.|||.:.|
  Fly   397 YCRSEL---PGVYTRVSSYIDWIASIV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/260 (25%)
Tryp_SPc 46..261 CDD:214473 63/257 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 67/270 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.