DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG13318

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:280 Identity:66/280 - (23%)
Similarity:108/280 - (38%) Gaps:40/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLV-LCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKN-NQFICDGTLVHKLFVLTAA 73
            ||| .||..:....::...|..|........:....||.|::... :.::..|.|:....|||||
  Fly   139 GLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVLTAA 203

  Fly    74 SCISKDSQLY--VLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEV--T 134
            ..:......|  |..|.::....:......:.| ::....:.:|.|||..||:.:|:|...|  |
  Fly   204 HKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVY-ISNVYVNPSFNPNNLQNDVAILKLSTPVSLT 267

  Fly   135 HYAHIRPICIILDHVVKSAPFERFEG-----FGWQQQ---GTEASSQVRQTVYLSQKKPFECH-- 189
            ..:.:..:|:         |...|.|     .||.:.   .|.|...:.:.|.:.......|.  
  Fly   268 SKSTVGTVCL---------PTTSFVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAA 323

  Fly   190 ----RNGQLLPINEGQF-CAGNR-DRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPT 248
                |.|....::...| |||.. .:..|..:.||||... :.||..:   ||||::|.. |:..
  Fly   324 LQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCT-SNGVWYV---VGLVAWGIG-CAQA 383

  Fly   249 ---SVYTDVVAFKDWIYNTV 265
               .||.:|..:..||..|:
  Fly   384 GVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/241 (24%)
Tryp_SPc 46..261 CDD:214473 56/238 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 58/247 (23%)
Tryp_SPc 169..399 CDD:214473 56/244 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.