DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG9372

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:101/237 - (42%) Gaps:41/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNN-QFI-CDGTLVHKLFVLTAASCISKDSQ--LYVLFGMYNQYRDASQFFNNE---- 102
            ||||::.:.. .|: |.|.|:....|||||.||.|.::  ::|..|.||.:      ..||    
  Fly   186 PWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTH------MLNETRAR 244

  Fly   103 QYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFER--------FE 159
            .:.:|..:.|.::.|.|..|||.::|:........:|.|:|:        .|...        ..
  Fly   245 DFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCM--------PPVNEDWSDRNAIVT 301

  Fly   160 GFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAG--NRDRSFCRSNSGSPLTA 222
            |:|.|:.| ...|.:...|.|...|..:| |:..:..:.:...|||  ...:..|:.:||.||..
  Fly   302 GWGTQKFG-GPHSNILMEVNLPVWKQSDC-RSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLV 364

  Fly   223 DFTYGVKNITVQVGLVSYGSELCSP---TSVYTDVVAFKDWI 261
            ...   ....|.:|:||:|.. |..   ..:||.|..:.|||
  Fly   365 QLP---NQRWVTIGIVSWGVG-CGQRGRPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 64/237 (27%)
Tryp_SPc 46..261 CDD:214473 62/235 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 62/235 (26%)
Tryp_SPc 176..402 CDD:238113 62/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.