DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG18223

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:250 Identity:63/250 - (25%)
Similarity:98/250 - (39%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IYKNNQFICDGTLVHKLFVLTAASC-------ISKDSQLYVLFGMYNQYRDASQF-FNNEQYGVA 107
            ::.:|.| |.|.::.:.::||:|.|       :.:...|.|:.|..|:.:..... .|.|...:.
  Fly    72 LFGDNHF-CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIF 135

  Fly   108 VALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVK-----SAPFERFEGFGWQQ-- 165
            |..:.:.|..||    |.|:.|       |...|:...|..|:.     ..|...:...||.:  
  Fly   136 VPDKFTVFNTNN----IALMML-------AKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIF 189

  Fly   166 QGTEASSQVRQTVYLSQKKPFECHRNGQLLP----------INEGQFCAGN----RDRSFCRSNS 216
            :|...:|.:             .|.:.:|||          ..|...||||    .|.:.|..::
  Fly   190 KGGPLASDI-------------LHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDT 241

  Fly   217 GSPLTADFTYGVKNITVQVGLVSYGSELCSPT--SVYTDVVAFKDWIYNTVRNFE 269
            ||||       :.|.|| .|:|||.....|.|  |:||:|....|||...:.|.|
  Fly   242 GSPL-------IFNETV-FGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNNE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/243 (25%)
Tryp_SPc 46..261 CDD:214473 59/240 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/243 (25%)
Tryp_SPc 60..280 CDD:214473 59/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.