DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG7542

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:106/254 - (41%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYN---QYRDA 95
            |::|.:.:|    |           |.|||:...:::|||.|:.....:.|..|..|   :..:.
  Fly    45 NVSFGNWST----W-----------CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEG 94

  Fly    96 SQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP------ 154
            .:....|:.|:.|   |||:..:..||||.|:||...|.....||         ..|.|      
  Fly    95 QERIMVEKSGIIV---HSNYMASTVVNDISLIRLPAFVGFTDRIR---------AASLPRRLNGQ 147

  Fly   155 ---FERFEGF--GWQQQGTEASSQVRQTV-YLSQKKPFECHRNGQLL---PINEGQFCAGNRD-R 209
               :|....|  ||.:: ::||..|...: |:  :.|...|...::.   .::|...|..... :
  Fly   148 FPTYESIRAFASGWGRE-SDASDSVSPVLRYV--EMPIMPHSLCRMYWSGAVSEKMICMSTTSGK 209

  Fly   210 SFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSEL-CSP--TSVYTDVVAFKDWIYNTV 265
            |.|..:||.||    .|...|.:..:|..|:|:.: |..  .:|:|.:.::.|||.|.:
  Fly   210 STCHGDSGGPL----VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 59/239 (25%)
Tryp_SPc 46..261 CDD:214473 57/236 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 62/251 (25%)
Tryp_SPc 27..260 CDD:214473 60/248 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.