DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG10469

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:227 Identity:62/227 - (27%)
Similarity:98/227 - (43%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KNNQFICDGTLVHKLFVLTAASCIS--KDSQLYVLF--GMYNQYRDASQFFNNEQYGVAVALQHS 113
            |:...:|.||::...:::|||.|:.  |.:...||.  |....: |..:...|..|.:.    |.
  Fly    49 KDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSF-DDKEIVVNRSYTIV----HK 108

  Fly   114 NFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTV 178
            .|......|||.|::|..::|...:|:|  ..|....|:....:....||.....:..|||.|.:
  Fly   109 KFDRKTVTNDIALIKLPKKLTFNKYIQP--AKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYI 171

  Fly   179 ---YLSQKKPFECHR--NGQL-----LPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITV 233
               .:|.|   ||.|  |.||     ..::.|..|..::....||.:||.|:..|  .|.:.:  
  Fly   172 RAPIISNK---ECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD--DGSRTL-- 229

  Fly   234 QVGLVSYG----SELCSPTSVYTDVVAFKDWI 261
             ||:||:|    .:|..| .|.|.|.::..||
  Fly   230 -VGIVSHGFDGECKLKLP-DVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/227 (27%)
Tryp_SPc 46..261 CDD:214473 60/225 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 60/225 (27%)
Tryp_SPc 24..260 CDD:238113 62/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.