DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:233 Identity:47/233 - (20%)
Similarity:82/233 - (35%) Gaps:74/233 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFG-------MYNQYRDASQFFNNEQYGVAVALQHSNFR 116
            |.|:::...:|:||..|......:.:.:|       .|..:...|.|           ::|    
  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDF-----------IEH---- 115

  Fly   117 PNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP-----FERFEGF-----GWQQQGTEAS 171
               |..||.|:|. ..|..::.:..:         ..|     :..::|:     ||.:...|..
  Fly   116 ---GSGDISLIRT-PHVDFWSLVNKV---------ELPRYDDRYNNYQGWWALVSGWGKTSDEGG 167

  Fly   172 -SQVRQTVYLSQKKPFECHR-----NGQLL----PINEGQFCAGNRDRSFCRSNSGSPLTADFTY 226
             |:....|.:...:...|..     :|.|:    |.|:|.          |..:||.||.     
  Fly   168 VSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGT----------CSGDSGGPLV----- 217

  Fly   227 GVKNITVQVGLVSYGSE---LCSPTSVYTDVVAFKDWI 261
             :.:...|||:||:||.   |.:.......|.::.|||
  Fly   218 -IHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 47/233 (20%)
Tryp_SPc 46..261 CDD:214473 45/231 (19%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 45/231 (19%)
Tryp_SPc 41..257 CDD:238113 47/233 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.