DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:215 Identity:53/215 - (24%)
Similarity:90/215 - (41%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVND 123
            |.|:|:...:|||||.|......:.|..|.  ..|.:::..:.......:.  ||.:...|..||
  Fly    67 CGGSLIGSTWVLTAAHCTDGVQSVTVYLGA--TVRTSAEITHTVSSSDIII--HSGWNSANLRND 127

  Fly   124 IGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEG-----FGWQQQGTEASSQVR---QTVYL 180
            |.|:::   ....:..|...:.|..:..|  :..|.|     .||.:. ::.||.|.   |.|.|
  Fly   128 ISLIKI---PATSSSSRISAVKLPSISNS--YSTFVGDVAVASGWGRT-SDTSSGVATNLQYVDL 186

  Fly   181 SQKKPFECHRNGQLLPINEGQFCAGNRD-RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSEL 244
            :.....:|.:......:.:...|....| :|.|..:||.||.      :|:.:.|:||.|:|:..
  Fly   187 TVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLV------LKSSSEQIGLTSFGASA 245

  Fly   245 -CSP--TSVYTDVVAFKDWI 261
             |..  .:.:|.|.::.|||
  Fly   246 GCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 53/215 (25%)
Tryp_SPc 46..261 CDD:214473 51/213 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 51/213 (24%)
Tryp_SPc 38..268 CDD:238113 53/215 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.