DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG6462

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:230 Identity:58/230 - (25%)
Similarity:95/230 - (41%) Gaps:51/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNF--RPN--- 118
            |.|:|:...||||||.|::......:       |..|:.|.:.|.....:.:.|.:|  .|:   
  Fly   106 CGGSLITLQFVLTAAHCLTDAIAAKI-------YTGATVFADVEDSVEELQVTHRDFIIYPDYLG 163

  Fly   119 -NGVNDIGLLRLYGEVTHYAHIRPICI---------ILDHVVKSAPFERFEGFGWQQQGTEASSQ 173
             .|.:|:.|:||..:|.....::||.:         ::..||..:        ||...|.....:
  Fly   164 FGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLS--------GWGYLGDSTDKR 220

  Fly   174 VRQTVYLS----QKKPFECHRNGQLLP---INEGQFCA-GNRDRSFCRSNSGSPLTADFTYGVKN 230
            .|...||.    .::...|:    .||   ......|. |:..|..|..:||.|:    .|..:|
  Fly   221 TRLLQYLDAEVIDQERCICY----FLPGLVSQRRHLCTDGSNGRGACNGDSGGPV----VYHWRN 277

  Fly   231 ITVQVGLVSYGS----ELCSPTSVYTDVVAFKDWI 261
            ::..:|:.|:||    |:..|| |||.:.|:..||
  Fly   278 VSYLIGVTSFGSAEGCEVGGPT-VYTRITAYLPWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/230 (25%)
Tryp_SPc 46..261 CDD:214473 56/228 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 56/228 (25%)
Tryp_SPc 77..314 CDD:238113 58/230 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.