DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and yip7

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:228 Identity:54/228 - (23%)
Similarity:94/228 - (41%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFGM-------YNQYRDASQFFNNEQYGVAVALQHSNFR 116
            |.|:::...:|||||.|....:.:.:.:|.       :.|...:|:|..:|.| :|:.::     
  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESY-LALTIR----- 126

  Fly   117 PNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEG-----FGWQQQGTEASSQVRQ 176
                 |||.|::. ..|:..|.:..|.:    ...|..:..:||     .||.....:|::..|.
  Fly   127 -----NDISLIQT-SSVSFSATVNKISL----PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRD 181

  Fly   177 TVY-----LSQKKPFECHRNGQLLPINEGQFCAGNRDR-SFCRSNSGSPLTADFTYGVKNITVQV 235
            ..|     :|..|   |......|.:.....|....:: |.|:.:||.||..|        .|.:
  Fly   182 LQYVDLTIISNSK---CQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD--------GVLI 235

  Fly   236 GLVSYGS----ELCSPTSVYTDVVAFKDWIYNT 264
            |..|:||    |..:| :.:|.:..::|||..|
  Fly   236 GATSFGSADGCESGAP-AAFTRITYYRDWIKET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 53/226 (23%)
Tryp_SPc 46..261 CDD:214473 51/223 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 51/223 (23%)
Tryp_SPc 40..267 CDD:238113 53/226 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.