DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG9897

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:296 Identity:72/296 - (24%)
Similarity:118/296 - (39%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLT 71
            |.|:.:|....|| |.|::.        ||.|....:.|||.|||..|::..|.|.::.|.::||
  Fly     5 LILLQIVALPWLA-LGDQRI--------INGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILT 60

  Fly    72 AASCISKDS--QLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVT 134
            ||.|:...|  .:.|..|      .:|...:....|:.....||.:......|::.||:....:.
  Fly    61 AAKCVDGYSARSIQVRLG------TSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLN 119

  Fly   135 HYAHIRPI-----------------C---------IILDHVVKSAPFERFEGFGWQQQGTEASSQ 173
            ....|:||                 |         :|||..:.|...|:......|..||    |
  Fly   120 TTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGT----Q 180

  Fly   174 VRQTVYLSQKKPFECHRNGQLLP------INEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNIT 232
            ||   .||||   :|..:.:::|      |::...|..:..:..|.::.||||..|        .
  Fly   181 VR---ILSQK---QCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVID--------N 231

  Fly   233 VQVGLVSYGSELCS-PTSVYTDVVAFKDWIYNTVRN 267
            ..||::|...  || ...||.:::...:|:.:..::
  Fly   232 KLVGILSRAG--CSIKPDVYANILGHTNWLDSNTKD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/252 (24%)
Tryp_SPc 46..261 CDD:214473 60/249 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 64/269 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.