DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG13527

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:115/296 - (38%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSLALIGLVLCQGLAQLLDKKCHDPKTSENINFNHG--ATETAPWMASI-------YKNNQFICD 60
            :::.:..:|:..|..::  |:...||.       ||  ..|.|.::.||       |..:...|.
  Fly     8 VAILITVMVILSGAHRM--KRLSSPKF-------HGDETLELAKYVVSIRSRTPNKYFGDNHYCG 63

  Fly    61 GTLVHKLFVLTAASCISKDSQ-------LYVLFGMYNQYRDASQFFNNEQYGVAVALQHS----- 113
            |.|:...:|:|||.|:...|:       |.|:.|..::.|...        |.:|....|     
  Fly    64 GGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTP--------GKSVCSPVSSLYVP 120

  Fly   114 -NFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP--FERFEGFGWQQQ--GTEASSQ 173
             ||..:|..| :.|::|..::...   .|....| |:.|.||  ..|....||.:.  |...:..
  Fly   121 KNFTMHNTFN-MALMKLQEKMPSN---DPRIGFL-HLPKEAPKIGIRHTVLGWGRMYFGGPLAVH 180

  Fly   174 VRQT-VYLSQK---KPFECHRNGQLLPINEGQFCAGNR----DRSFCRSNSGSPLTADFTYGVKN 230
            :.|. |.|...   |.:..|       ..:|..||||.    |...|..:.||||.:.       
  Fly   181 IYQVDVVLMDNAVCKTYFRH-------YGDGMMCAGNNNWTIDAEPCSGDIGSPLLSG------- 231

  Fly   231 ITVQVGLVSY--GSELCSPTSVYTDVVAFKDWIYNT 264
             .|.||:|:|  |....:..||||||.:...||.:|
  Fly   232 -KVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/251 (26%)
Tryp_SPc 46..261 CDD:214473 63/248 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 65/250 (26%)
Tryp_SPc 43..263 CDD:214473 63/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.