DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30283

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:133/270 - (49%) Gaps:13/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLSLALIGLVLCQGLAQLLDKKCHD-PKTSENINFNHGA-TETAPWMASIYKNNQFICDGTLVHK 66
            ||..|...:||.......|:..|.. |.:...|...|.| ..:|||||.:.....|.|.|||:..
  Fly    11 VLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITN 75

  Fly    67 LFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYG 131
            .||||:|.||: :.:|.|..|:..:..:|.:|      .|.....|:::..:.  :|:.||||..
  Fly    76 RFVLTSAHCIA-NGELKVRLGVLEREAEAQKF------AVDAMFVHTDYYFDQ--HDLALLRLAK 131

  Fly   132 EVTHYAHIRPICIILDHVVKSAP--FERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQL 194
            .|.:..:|.|||::||.:||:..  ..:|..:||.:..:.:||::.|...|......||.:....
  Fly   132 RVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPH 196

  Fly   195 LPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKD 259
            ..||....||.:.:.:.|..:||.||||..||....:..|.|:.|:|...||..:|:|:|:...|
  Fly   197 QQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLD 261

  Fly   260 WIYNTVRNFE 269
            ||.||||..|
  Fly   262 WIVNTVRRAE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 71/219 (32%)
Tryp_SPc 46..261 CDD:214473 69/216 (32%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 73/229 (32%)
Tryp_SPc 43..266 CDD:238113 75/231 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.