DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG8738

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:268 Identity:71/268 - (26%)
Similarity:115/268 - (42%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QGLAQLLDKKCHDPKTSENINFNHGATETA--PWMASIY-KNNQFICDGTLVHKLFVLTAASCI- 76
            :||...||            .:|:|.:..|  |||.::. ....|:|.|||:|...|||:|..: 
  Fly   194 KGLYYQLD------------GYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVF 246

  Fly    77 --SKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHI 139
              |:|| |.|..|.:: ....::....:...::...:|.||......|||.|:.|........||
  Fly   247 NRSEDS-LLVRAGDWD-LNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHI 309

  Fly   140 RPICI------ILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHR------NG 192
            :|||:      .::..::||.. ...|:|.:...:.....:.:.:.|.......|.|      .|
  Fly   310 QPICLPPPETPQMEAELRSASC-LATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLG 373

  Fly   193 QLLPINEGQFCAGN-RDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSV---YTD 253
            :...::....|||. :.:..|..:.||||..... |.|:....|||||:|.| |:...|   ||:
  Fly   374 RRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLP-GQKDRYQLVGLVSWGIE-CAEKDVPAAYTN 436

  Fly   254 VVAFKDWI 261
            |...::||
  Fly   437 VAYLRNWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 64/236 (27%)
Tryp_SPc 46..261 CDD:214473 62/234 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 65/243 (27%)
Tryp_SPc 207..444 CDD:214473 63/241 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.