DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and OVCH2

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:413 Identity:111/413 - (26%)
Similarity:164/413 - (39%) Gaps:97/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCISKD---SQLYVLFGMYNQYRDASQFFNNEQ-YGV 106
            ||..|:.:..:.||.|::|...:|:|||.||:..   |.|.|..|.|    |.||....|| ..:
Human    68 PWQVSLKQRQKHICGGSIVSPQWVITAAHCIANRNIVSTLNVTAGEY----DLSQTDPGEQTLTI 128

  Fly   107 AVALQHSNFRPNNGVN-DIGLLRLYGEVTHYAHIRPICIILDHVVKSAP--FERFE-GF-----G 162
            ...:.|.:|.....:: ||.||::.|.......:.|||:         |  .|:|| ||     |
Human   129 ETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICL---------PELREQFEAGFICTTAG 184

  Fly   163 WQQQGTEAS--SQVRQTVYLSQKKPFECHRNGQLL----PINEGQF-CAGNRD--RSFCRSNSGS 218
            |.:. ||..  |||.|.|.|......||  ...||    ||:...| |.|..|  |..|:.:||.
Human   185 WGRL-TEGGVLSQVLQEVNLPILTWEEC--VAALLTLKRPISGKTFLCTGFPDGGRDACQGDSGG 246

  Fly   219 PLTADFTYGVKNITVQVGLVSYG-------------SELCSPTSVYTDVVAFKDWIYNTVRNFET 270
            .|......|...:   .|:.|:|             |:..|| .::||:.....||:..::.   
Human   247 SLMCRNKKGAWTL---AGVTSWGLGCGRGWRNNVRKSDQGSP-GIFTDISKVLPWIHEHIQT--- 304

  Fly   271 KGDQVVYEECRSNWA--EDVLVRLWEVSLHQNTFSGVL-----ITNRFVLTVASAFPNIPLVMKV 328
             |::   .:....|.  :||:|...|..||   |...|     ...|.|.|         |::..
Human   305 -GNR---RKSSRAWCSEQDVIVSGAEGKLH---FPESLHLYYESKQRCVWT---------LLVPE 353

  Fly   329 ETKYLKSF---DVESIHTHPRFTHSSMDNNIALLKLAHDVPNSDLVKPICIVPSPKLPRMLTTLV 390
            |...|.||   ||||.| |...:..|:::..........:|:|.|:..         ..:....|
Human   354 EMHVLLSFSHLDVESCH-HSYLSMYSLEDRPIGKFCGESLPSSILIGS---------NSLRLKFV 408

  Fly   391 DETTNDFRGVRNVTLNAI--NHI 411
            .:.|::..|. |:|..|:  |:|
Human   409 SDATDNAAGF-NLTYKALKPNYI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 75/252 (30%)
Tryp_SPc 46..261 CDD:214473 73/249 (29%)
Tryp_SPc 293..484 CDD:304450 31/129 (24%)
Tryp_SPc 293..481 CDD:214473 31/129 (24%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 73/249 (29%)
Tryp_SPc 56..301 CDD:238113 75/252 (30%)
CUB 320..424 CDD:238001 30/126 (24%)
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.