DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:281 Identity:70/281 - (24%)
Similarity:108/281 - (38%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLAQLLDKKCHD---PKTSE---NINFNHGATE-TAPWMASIYKNNQFICDGTLV 64
            ||::.|.:..  |...|:|...   ||.::   .|...:.|.| .||:...:..:..:.|.|:::
  Fly     5 LAILALAVAS--ASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSII 67

  Fly    65 HKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRL 129
            ...:||||..||...:.:.|.||.  .:|..:||  ....|....::|||       .||.|:|:
  Fly    68 AHDWVLTAEHCIGDAASVIVYFGA--TWRTNAQF--THTVGNGNFIKHSN-------ADIALIRI 121

  Fly   130 YGEVTHYAHIRPICIILD--HVVKSAPF----ERFEGF--------GWQQQGTEASSQV---RQT 177
                   .|:       |  |:|.....    :|:..:        ||  .||...|.:   .|.
  Fly   122 -------PHV-------DFWHMVNKVELPSYNDRYNNYNEWWAVACGW--GGTYDGSPLPDWLQC 170

  Fly   178 VYLSQKKPFECHRNGQLLPINEGQFCAGNRD-RSFCRSNSGSPL-TADFTYGVKNITVQVGLVSY 240
            |.|......||  ......:.:...|....| :|.|..:||.|| |.|   |.|.:.|...:.|.
  Fly   171 VDLQIVHNEEC--GWTYGSVGDNVICTRTVDGKSICGGDSGGPLVTHD---GSKLVGVSNFVSSN 230

  Fly   241 GSELCSPTSVYTDVVAFKDWI 261
            |.:..:|.. :..|....|||
  Fly   231 GCQSGAPAG-FQRVTYHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/235 (25%)
Tryp_SPc 46..261 CDD:214473 56/233 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 60/246 (24%)
Tryp_SPc 37..253 CDD:238113 62/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.