DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG3117

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:236 Identity:58/236 - (24%)
Similarity:101/236 - (42%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCIS--KDSQLYVLFGMYNQYRDASQFFN---NEQYG 105
            ||:.:::....::..|:|:....|||||..::  ..:.:.|..|.::  ..:|:..|   :.|  
  Fly   104 PWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWD--LSSSEKLNPPMDRQ-- 164

  Fly   106 VAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFER----FEGFGWQQQ 166
            |...::|..|..::|.||:.||.|.......|:|:.|.:    .:....|:|    ..|:| .:.
  Fly   165 VIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRL----PIPDKTFDRRICTVAGWG-MRS 224

  Fly   167 GTEASSQ-VRQTVYLSQKKPFECHRNGQLLPINEGQ------FCAGNRD-RSFCRSNSGSPLTAD 223
            .|:...| ::|.|.|...:..:|.|..:|..:....      .|||..: |..|....|..|...
  Fly   225 STDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCS 289

  Fly   224 FTYGVKNITVQVGLVSYG---SELCSPTSVYTDVVAFKDWI 261
            .. ...|...|.|:||:|   .:...||: :|.|..|.:||
  Fly   290 LD-DDPNRYEQAGIVSFGVGCGQANVPTT-FTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/236 (25%)
Tryp_SPc 46..261 CDD:214473 56/234 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 58/236 (25%)
Tryp_SPc 95..328 CDD:214473 56/234 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.