DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG11911

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:72/274 - (26%)
Similarity:119/274 - (43%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSLALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASI---YKNNQFICDGTLVHK 66
            |.:||:.......|:..|.|......|...||.......:||::.|:   |..:..||.|||::|
  Fly     8 LVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINK 72

  Fly    67 LFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYG 131
            .:::|||.|||:...:.::.|::.: .:..:.  .:|..|.....|..:....|..||.||.:..
  Fly    73 DWIVTAAHCISEPVGMSIIAGLHTR-AEVDEL--TQQRQVDFGRVHEKYTGGVGPYDIALLHVNE 134

  Fly   132 EVTHYAHIRPICIILDHVVKSAPFERFEG----FGWQQQGTE--ASSQVRQTVYLSQKKPFECHR 190
            .......::|..:.....|       .||    :||.|..:.  :.::..|||........||..
  Fly   135 SFIFNEWVQPATLPSREQV-------HEGETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKE 192

  Fly   191 N-GQLLPINEGQFCAGN--RDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYG---SELCSPTS 249
            . .:..||.|...|:.:  :.:|.|..:||.||..:||.....:   :|:||:|   ..|.:..|
  Fly   193 ELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSEL---IGIVSWGYIPCGLANMPS 254

  Fly   250 VYTDVVAFKDWIYN 263
            :||.|.|:.|||.|
  Fly   255 IYTKVSAYIDWITN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/233 (27%)
Tryp_SPc 46..261 CDD:214473 59/229 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 65/245 (27%)
Tryp_SPc 37..266 CDD:214473 62/241 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.