DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Hayan

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:251 Identity:67/251 - (26%)
Similarity:105/251 - (41%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNN----QFICDGTLVHKLFVLTAASCISKDSQL--YVLFGMYN------QYRDASQF 98
            |.||:|..|:    .|.|.|:|:...||||||.|::.|...  :|..|..|      .|:|.:  
  Fly   397 PHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQDIN-- 459

  Fly    99 FNNEQYGVAVALQ-HSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERF-EGF 161
                    .:.:| |.::..::...||.:|:|..:......|||.|:..|.....|.::.| .|:
  Fly   460 --------VIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGW 516

  Fly   162 GWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLP---------INEGQFCAG--NRDRSFCRSN 215
            |.......|.|::.....|......||:.:....|         :...|.||.  |:.:..|:.:
  Fly   517 GVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGD 581

  Fly   216 SGSPL-----TADFTYGVKNITVQVGLVSYGSELCSPT-SVYTDVVAFKDWIYNTV 265
            ||.||     ..|.||.:      ||::|.|....:.| .:||.|.:|.|:|...|
  Fly   582 SGGPLILEIDDVDGTYSI------VGVISSGFGCATKTPGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 66/248 (27%)
Tryp_SPc 46..261 CDD:214473 65/245 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 65/245 (27%)
Tryp_SPc 385..630 CDD:238113 66/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.