DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG31220

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:275 Identity:78/275 - (28%)
Similarity:114/275 - (41%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CHDPKTSENINFNHGATE----TAPWMAS-IYKNNQFI---------CDGTLVHKLFVLTAASCI 76
            |..|:|:..:   .|.||    ..||:|. :|:|....         |.|:|::..:|||||.|:
  Fly    95 CGKPQTTNRV---IGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCV 156

  Fly    77 SKDSQLY---VLFGMYNQYRDASQFFNNEQ---------YGVAVALQHSNFRPNNGV--NDIGLL 127
            : |:.|.   |..|.:....:........:         ..|.....|:::.|.|..  |||.|:
  Fly   157 T-DTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALV 220

  Fly   128 RLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGT-EASSQVRQTVYLSQKKPFEC--- 188
            ||...|.:.....||| :||:......|:.:.. ||.:.|. :..|:|.:...:..:||.||   
  Fly   221 RLKEPVRYTMAYYPIC-VLDYPRSLMKFKMYVA-GWGKTGMFDTGSKVLKHAAVKVRKPEECSEK 283

  Fly   189 --HRN-GQLLPINEGQFCAGNRD-RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP-- 247
              ||: |...     |.|||..| |..|..:|||||........:.||...|:.|||.. |..  
  Fly   284 YAHRHFGPRF-----QICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGP-CGTIG 342

  Fly   248 -TSVYTDVVAFKDWI 261
             .||:|....|..||
  Fly   343 WPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 72/251 (29%)
Tryp_SPc 46..261 CDD:214473 70/249 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 73/265 (28%)
Tryp_SPc 104..360 CDD:238113 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.