DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG31200

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650909.1 Gene:CG31200 / 326124 FlyBaseID:FBgn0051200 Length:284 Species:Drosophila melanogaster


Alignment Length:303 Identity:62/303 - (20%)
Similarity:117/303 - (38%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLSLALIG-LVLCQGLAQLLDKKC-----HDPKTSENINFNHGATETAPWMASI-------YKN 54
            ::|:||.:| |.:.:.....||:|.     ...:.|||           ||:..:       |:|
  Fly     9 QLLTLAWLGALTMAEFRCGRLDEKLLYTTNEQAEPSEN-----------PWVGILLEDQGNRYEN 62

  Fly    55 NQFICDGTLVHKLFVLTAASCI------SKDSQLYVLFGMYNQYRDASQFFN----------NEQ 103
            .:  |...::::|.:|:.|:|:      |.|::...:.|::::.....:..:          .|.
  Fly    63 TR--CSVVIINELHILSTATCVKRFSQRSGDTKAVAMLGVWDETDSPEEELSCNDKDFCVPGPEL 125

  Fly   104 YGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGT 168
            |.|.....|.....:.|.||:.:|||...|.....::|||:......::.........|:....:
  Fly   126 YKVVEIKVHPQTDKDTGDNDLAILRLEKPVEWTNWVQPICLEGTSEPETLTNRNLHYTGFNHMAS 190

  Fly   169 EASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPL----TAD------ 223
            |....:..||  |.:|..:...:..|:|:|  |.|.....|:  :...|:||    ..|      
  Fly   191 EKGKGLAMTV--STQKCKQLTSSSVLVPVN--QLCGYPVKRT--KFYPGAPLMDIDVRDEKPHNF 249

  Fly   224 FTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWIYNTVR 266
            :..|:....|..|..:        |.||.:|...:.||...::
  Fly   250 YLVGILVRNVDAGQAT--------TQVYQNVRRARSWIMENLK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 51/250 (20%)
Tryp_SPc 46..261 CDD:214473 49/247 (20%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG31200NP_650909.1 Tryp_SPc 39..282 CDD:304450 54/269 (20%)
Tryp_SPc 39..279 CDD:214473 52/266 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.