DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and plg

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:281 Identity:68/281 - (24%)
Similarity:112/281 - (39%) Gaps:63/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CQGLAQLLDKKCHDPKTSENINFNH------GATETAPWMASIYKNNQF-ICDGTLVHKLFVLTA 72
            |:.|      ||..|.|.....|..      ....:.||..|:....:. .|.|||:...:|:||
Zfish   570 CESL------KCGQPATKPKRCFGRIVGGCVSKPHSWPWQISLRTRGKIHFCGGTLIDPQWVVTA 628

  Fly    73 ASCISKD---SQLYVLFGMY--------NQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGL 126
            |.|:.:.   |...::.|::        .|.||.::.....                 ...||.|
Zfish   629 AHCLERSDSPSAYKIMLGIHTERATESSKQERDVTKIIKGP-----------------AGTDIAL 676

  Fly   127 LRLYGEVTHYAHIRPICI-ILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVY-LSQKKPFECH 189
            |:|.........:.|:|: ..|::|.|.......|:| :.|.|.....:::|.: :.:.|  .|:
Zfish   677 LKLDRPALINDKVSPVCLPEKDYIVPSNTECYVTGWG-ETQDTGGEGYLKETGFPVIENK--VCN 738

  Fly   190 R----NGQLLPINEGQFCAGNRD--RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYG---SELC 245
            |    ||:   :.:.:.||||.:  ...|:.:||.||..   | .:|..|..|:.|:|   :...
Zfish   739 RPSFLNGR---VKDHEMCAGNIEGGNDSCQGDSGGPLVC---Y-AQNTFVLQGVTSWGLGCANAM 796

  Fly   246 SPTSVYTDVVAFKDWIYNTVR 266
            .| .|||.|..|.|||..:::
Zfish   797 KP-GVYTRVSKFVDWIERSIK 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/240 (25%)
Tryp_SPc 46..261 CDD:214473 59/237 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527 1/1 (100%)
Tryp_SPc 589..813 CDD:238113 61/251 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.