DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG11664

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:257 Identity:64/257 - (24%)
Similarity:95/257 - (36%) Gaps:77/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKDS---QLYVLFGMYNQYRDASQFF 99
            |:|      ::..|| ..||:..|:|....:|||.|.|..|::   :|.|..|    ||..:..|
  Fly    33 NYG------YVMQIY-GPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG----YRWIAWEF 86

  Fly   100 NNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHI--------RPICIILDHVVKSAPFE 156
            ..:|  ||..|:|..|.|....|||.:||:...::| :|:        ||:          .|..
  Fly    87 RGKQ--VAGLLRHPKFSPLTLRNDIAVLRVKAAISH-SHMINYIGLCSRPL----------TPLN 138

  Fly   157 RF----EGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLP-INEGQFCA-GNRDRSFCRSN 215
            .|    |..||..... |......:|.:..:|  .|.   |..| |:.|..|| .......|..:
  Fly   139 MFAPPQELAGWNLMHI-AQPLKSMSVQVEPEK--NCR---QWFPQISGGVICASATMGEGLCYGD 197

  Fly   216 SGSPLTADFTYGVKNITVQVGLVSYGSELCSPT------------SVYTDVVAFKDWIYNTV 265
            ||.||.:                  |.|:|...            :::|||...:.:|...|
  Fly   198 SGDPLIS------------------GGEVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/246 (25%)
Tryp_SPc 46..261 CDD:214473 60/243 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 61/242 (25%)
Tryp_SPc 38..237 CDD:214473 60/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.