DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:231 Identity:63/231 - (27%)
Similarity:100/231 - (43%) Gaps:32/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCI--SKD-SQLYVLFGMYNQYRDASQFFNNEQYGVA 107
            ||.:|:..:....|..||:...::::||.|.  .|| |:....||...|....:.       |:.
  Rat   225 PWQSSLQWDGSHRCGATLISNTWLVSAAHCFRTHKDPSRWTASFGATLQPPKLTT-------GIR 282

  Fly   108 VALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERF--EGFGWQQQGTEA 170
            ..:.|..:...:...||.|:.|...|.....:..:| :.|...:..|.:|.  .|||..:....|
  Rat   283 RIIVHEKYNYPSHDYDIALVELSRPVPCTNAVHKVC-LPDANHEFQPGQRMFVTGFGALRNDGFA 346

  Fly   171 SSQVRQTV--YLSQKKPFECHR----NGQLLPINEGQFCAG--NRDRSFCRSNSGSPLTADFTYG 227
            .:.:||..  |:..:   .|:|    ||.:.|   ...|||  ..::..|:.:||.||.   |..
  Rat   347 QNYLRQVQVDYIDTQ---TCNRPQSYNGAITP---RMLCAGFLKGEKDACQGDSGGPLV---TPD 402

  Fly   228 VKNITVQVGLVSYGSELCSPT--SVYTDVVAFKDWI 261
            |:::....|:||:|.|...|.  .|||.|.||:|||
  Rat   403 VRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 63/231 (27%)
Tryp_SPc 46..261 CDD:214473 61/229 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 63/231 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.