DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Prss42

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:252 Identity:73/252 - (28%)
Similarity:106/252 - (42%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVAL 110
            ||..|:...:..:|.|:|::..:|||||.||....|..|..|..:.||        :...:.:.:
  Rat    96 PWQVSLRVRHMHVCGGSLLNSQWVLTAAHCIHSRVQYNVKMGDRSVYR--------QNTSLVIPI 152

  Fly   111 Q----HSNFRPNNGV-NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEG-----FGW-- 163
            |    |..|.....| |||.||:|...|...:.|.|||      |.:..|....|     .||  
  Rat   153 QNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPIC------VPTGTFHVKAGTKCWVTGWGK 211

  Fly   164 -----QQQGTEASSQVRQTVYLSQKKPFECHRNGQLLP---------INEGQFCA---GNRDRSF 211
                 .|..||...:|.|::.|.:    ||:   ::|.         :..|..||   |.:|.  
  Rat   212 PDPGAPQIPTEILQEVDQSIILYE----ECN---EMLKKMASTSVDLVKRGMVCAYKEGGKDA-- 267

  Fly   212 CRSNSGSPLTADFTYGVKNITVQVGLVSYGSELC---SPTSVYTDVVAFKDWIYNTV 265
            |:.:||.||:.:|    .|..||:|:||:|.. |   ....|||||..:..|:...|
  Rat   268 CQGDSGGPLSCEF----DNRWVQIGVVSWGIG-CGRKGHPGVYTDVAFYNKWLITVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 72/249 (29%)
Tryp_SPc 46..261 CDD:214473 71/246 (29%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 71/245 (29%)
Tryp_SPc 84..315 CDD:238113 71/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.