DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and GZMM

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:228 Identity:66/228 - (28%)
Similarity:108/228 - (47%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCIS-KDSQLYVLFGMYNQYRDASQFFNNEQYGVAVA 109
            |:|||:.:|...:|.|.|||..:|||||.|:: :.:||.::.|::........|.      :..|
Human    38 PYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFH------IKAA 96

  Fly   110 LQHSNFRPNNGV-NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFE-RFEGFGWQQQGTEASS 172
            :||..::|...: ||:.||:|.|:|.....|||:.:.....|.:|... ...|:|...||...|.
Human    97 IQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSR 161

  Fly   173 QVRQTVYLSQKKPFECHR----NGQLLPINEGQFC--AGNRDRSFCRSNSGSPLTADFTYGVKNI 231
            .:|: :.|.......|:.    ||.|.|   ...|  |.::|::.|:.:||.||..    |...:
Human   162 VLRE-LDLQVLDTRMCNNSRFWNGSLSP---SMVCLAADSKDQAPCKGDSGGPLVC----GKGRV 218

  Fly   232 TVQVGLVSYGSELCS---PTSVYTDVVAFKDWI 261
            ..:|  :|:.|.:|:   ...|.|.|..:..||
Human   219 LARV--LSFSSRVCTDIFKPPVATAVAPYVSWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 66/228 (29%)
Tryp_SPc 46..261 CDD:214473 64/226 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 66/228 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.