DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and GZMH

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:273 Identity:75/273 - (27%)
Similarity:117/273 - (42%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFI-------CDGTLV 64
            |.|:..:|..|..           |.|.|..:.....:.|:||.:    ||:       |.|.||
Human     5 LLLLAFLLTPGAG-----------TEEIIGGHEAKPHSRPYMAFV----QFLQEKSRKRCGGILV 54

  Fly    65 HKLFVLTAASCISKDSQLYVLFGMYN-QYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLR 128
            .|.||||||.|  :.|.:.|..|.:| :.::.:|.|    ..|...:.|..:.|.|..|||.||:
Human    55 RKDFVLTAAHC--QGSSINVTLGAHNIKEQERTQQF----IPVKRPIPHPAYNPKNFSNDIMLLQ 113

  Fly   129 LYGEVTHYAHIRPICIILDHV-VKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHR-- 190
            |..:......:||:.:..... ||........|:|:....|.|::  .|.|.|:.:|..:|.|  
Human   114 LERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATT--LQEVLLTVQKDCQCERLF 176

  Fly   191 NGQLLPINEGQFCAGN--RDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTD 253
            :|......|  .|.|:  :.::..:.:||.||...        .|..|::|||::..:|..||..
Human   177 HGNYSRATE--ICVGDPKKTQTGFKGDSGGPLVCK--------DVAQGILSYGNKKGTPPGVYIK 231

  Fly   254 VVAFKDWIYNTVR 266
            |..|..||..|::
Human   232 VSHFLPWIKRTMK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 67/230 (29%)
Tryp_SPc 46..261 CDD:214473 65/227 (29%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 68/242 (28%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.