DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Prss30

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:271 Identity:66/271 - (24%)
Similarity:101/271 - (37%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQ-FICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVA 109
            ||..|:....: .||.|:|:|:::|||||.|..:...              |.|::.:..|:.::
  Rat    43 PWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLN--------------SSFYHVKVGGLTLS 93

  Fly   110 L--QHSNFRPNNGV-------------NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFE 159
            |  .||.......:             .||.|||| ......:...|:|:    ....||..  .
  Rat    94 LTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRL-DTPLQPSQFSPVCL----PQAQAPLT--P 151

  Fly   160 G-----FGWQQQGTEASSQVRQTVYLSQKKPFECHR---------NGQLLPINEGQFCAG--NRD 208
            |     .||........:.|.|.:.:......:|.|         :|:.: |.....|||  ...
  Rat   152 GTVCWVTGWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRV-IQSDMLCAGFVEGQ 215

  Fly   209 RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPT--SVYTDVVAFKDWIYNTVRNFETK 271
            :..|:.:||.||..    .:.:..:|||:.|:|.....|.  .|||.|..:.|||..|:.  |..
  Rat   216 KDSCQGDSGGPLVC----AINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLA--ENH 274

  Fly   272 GDQVVYEECRS 282
            .|..   .|||
  Rat   275 SDAY---GCRS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/251 (24%)
Tryp_SPc 46..261 CDD:214473 58/248 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.