DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG33226

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:296 Identity:92/296 - (31%)
Similarity:140/296 - (47%) Gaps:44/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRVLSLALIGLVLCQGLAQ-LLDKKCHDPKTS--ENINFNHGA-TETAPWMASIYKNNQFICDG 61
            |..:|...::.|...:.|.| |||..|......  |.|...|.| .:..|||..|.:.....|.|
  Fly    10 MKWLLVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGG 74

  Fly    62 TLVHKLFVLTAASCISKDSQLYVLFGMYN----QYRDASQFFNNEQYGVAVALQ----HSNFRPN 118
            :|:..|||||||.|.|: .:|.|.||.|:    :|..:||:.:  .:|..:.::    ||::|..
  Fly    75 SLISSLFVLTAAHCHSR-YRLKVRFGRYSGITPRYLCSSQYCS--PFGPEIDVKRIFLHSSYRDY 136

  Fly   119 NGVNDIGLLRLYGEVTHYAHIRPICII-----------LDHVVKSAPFERFEGFGWQQQGTEASS 172
            :.. ||.|..|...|.:....||||::           |::|.      .|...||.:..::.:|
  Fly   137 HNY-DIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVA------MFNVTGWGKTESQLTS 194

  Fly   173 QVRQTVYLSQKKPFECHRN--GQLLPINEG--QFCAGNRDRSFCRSNSGSPLTADFTY-GVKNIT 232
            .:.||..|     |...|.  .|:.....|  ..|||:...|.|..:||.||:|:.|: |||. |
  Fly   195 TILQTTSL-----FHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKR-T 253

  Fly   233 VQVGLVSYGSELCSPTSVYTDVVAFKDWIYNTVRNF 268
            |..|::|||:..|...:|:|:|:.:.:||.:.|.||
  Fly   254 VLFGIISYGAPNCREVTVFTNVLRYSNWIRDIVHNF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 76/241 (32%)
Tryp_SPc 46..261 CDD:214473 74/238 (31%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 79/253 (31%)
Tryp_SPc 47..282 CDD:214473 77/250 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.