DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Sp212

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:103/239 - (43%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNN----QFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNN--EQY 104
            ||::::|...    .|.|.|:|:....|::||.|:.:.::..|:.|: .:| |...:..:  |..
  Fly   289 PWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGL-GRY-DLDDYGEDGAEMR 351

  Fly   105 GVAVALQHSNFRPNNGVN-DIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGF--GWQQQ 166
            .|...|.|.::...:..: ||.|:.:...||....|.|||:   ..|:::......||  ||.:.
  Fly   352 NVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICM---WTVEASRTVSTTGFIAGWGRD 413

  Fly   167 GTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSF-CRSNSGSPLTADFTYGVK- 229
            ...:.:|..:.|......|..|....:...:.|...||||||.|. |..:||..|.      || 
  Fly   414 EDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLM------VKQ 472

  Fly   230 -NITVQVGLVSYGSELCSPTS------VYTDVVAFKDWIYNTVR 266
             :..:..|:||.|....:.|.      :|.|:....:||...:|
  Fly   473 GDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/235 (26%)
Tryp_SPc 46..261 CDD:214473 58/232 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 60/235 (26%)
Tryp_SPc 277..511 CDD:214473 58/232 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.