DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and PRSS33

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:287 Identity:71/287 - (24%)
Similarity:110/287 - (38%) Gaps:48/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLSLALIGLVLCQGLAQLLDKKCHDPKTSENI-NFNHGATETAPWMASIYKNNQFICDGTLVHK 66
            :||.|.::|....||..   ...|..|:.|..| ....|.....||.|||......:|.|:|:..
Human     8 QVLLLLVLGAAGTQGRK---SAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAP 69

  Fly    67 LFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQH----SNFRPNNGVNDIGLL 127
            .:|||||.|..:.:    |...|.....|.:..:.....::|.::.    .::..:....|:.||
Human    70 QWVLTAAHCFPRRA----LPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALL 130

  Fly   128 RLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFE----- 187
            :|...|...|.::|:|:.:.. .:..|.......||        ..:|..|.|.:.:|.:     
Human   131 QLRRPVPLSARVQPVCLPVPG-ARPPPGTPCRVTGW--------GSLRPGVPLPEWRPLQGVRVP 186

  Fly   188 ------C---HRNGQLLPINE-----GQFCAG--NRDRSFCRSNSGSPLTADFTYGVKNITVQVG 236
                  |   :..|..:|..|     |..|||  ...:..|:.:||.|||.    ......|.||
Human   187 LLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTC----LQSGSWVLVG 247

  Fly   237 LVSYGSELCSPT--SVYTDVVAFKDWI 261
            :||:|.....|.  .|||.|..:..||
Human   248 VVSWGKGCALPNRPGVYTSVATYSPWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/243 (25%)
Tryp_SPc 46..261 CDD:214473 58/241 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 62/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.