DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Klk8

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:284 Identity:76/284 - (26%)
Similarity:118/284 - (41%) Gaps:70/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALIGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTA 72
            |..||...||...|..::|              ...:.||.|::::..:.||.|.||...:||||
Mouse    21 AWAGLTRAQGSKILEGREC--------------IPHSQPWQAALFQGERLICGGVLVGDRWVLTA 71

  Fly    73 ASCISKDSQLYVLFGMYN-QYRDASQFFNNEQYGVAVALQH---SNFRPNNGVNDIGLLRLYGEV 133
            |.|  |..:..|..|.:: |.||..:    ::..||.::||   :|..|.:..:||.|:||....
Mouse    72 AHC--KKQKYSVRLGDHSLQSRDQPE----QEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSA 130

  Fly   134 THYAHIRPI------------CIILDHVVKSAPFERFEGFGWQQQGTEASSQVR--QTVYLSQKK 184
            .....::|:            |||               .||   ||..|.|..  .|:..::.|
Mouse   131 NLGDKVKPVQLANLCPKVGQKCII---------------SGW---GTVTSPQENFPNTLNCAEVK 177

  Fly   185 PFECHRNGQLLP--INEGQFCAGNRD-RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELC- 245
            .:..::..:..|  |.||..|||:.: ...|:.:||.||..|   |:..     |:.|:||:.| 
Mouse   178 IYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCD---GMLQ-----GITSWGSDPCG 234

  Fly   246 --SPTSVYTDVVAFKDWIYNTVRN 267
              ....|||.:..:..||..|:.|
Mouse   235 KPEKPGVYTKICRYTTWIKKTMDN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 67/241 (28%)
Tryp_SPc 46..261 CDD:214473 65/238 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 67/265 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.