DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30323

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:238 Identity:48/238 - (20%)
Similarity:79/238 - (33%) Gaps:103/238 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPN 118
            :|.| |.|:|:...:|:|:..|:|...:           ...:|..|.:...|.|.......:|:
  Fly    50 DNHF-CAGSLLSAWWVVTSGCCVSTRPE-----------STPNQPSNRKNLRVVVFTPKRLKKPS 102

  Fly   119 -----------------NGVNDIGLLRL----------------------------YGEVTH--Y 136
                             :|..::.||:|                            :|.:.:  |
  Fly   103 PKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSY 167

  Fly   137 AHIRPIC----IILDHVVKSAPFERFEGFGWQQQGTEASS--QVR-QTVYLSQKKPFECHRNGQL 194
            .:|..:|    ::.|:.|.           |.|.|..:|.  |:| |.:...:.|| :|.|    
  Fly   168 VYISAMCPAFSMVYDNPVT-----------WFQDGPYSSELIQIRAQKISEYECKP-DCSR---- 216

  Fly   195 LPINEGQFC--------AGNRDRSFCRSNSGSPLTAD-FTYGV 228
                    |        .||    .|:.:.||||..| |.|||
  Fly   217 --------CLCMTSYTGRGN----MCQQDLGSPLFCDHFLYGV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 48/238 (20%)
Tryp_SPc 46..261 CDD:214473 48/238 (20%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 48/238 (20%)
Tryp_SPc 45..272 CDD:214473 48/238 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436706
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.