DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30289

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:319 Identity:92/319 - (28%)
Similarity:148/319 - (46%) Gaps:57/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALIGLVLCQGLA------QLLDKKCHDPKTSENINFNHGATET----APWMASIYKNNQFICDGT 62
            |:|..::|..:|      :||.:.|...|....:....|..:|    .|||..::.:..  |.|:
  Fly     6 AVIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP--CGGS 68

  Fly    63 LVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNN----EQYGVAVALQ--HSNFRPNNGV 121
            |:.:.||||||.|:|.: .|||..|.|..........||    :.|.::|.::  |.|:   ||:
  Fly    69 LIARQFVLTAAHCVSFE-DLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENY---NGI 129

  Fly   122 ---NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQK 183
               |||.|||:...|.:..::||||:::...::|.|.....|:|..:.|..:...:..|:|....
  Fly   130 TLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGWGETEYGQFSRILLNATLYNMDI 194

  Fly   184 KPFECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP- 247
            .......|.|   .:..|.|||:...:.|:.:||.||::.|.||.:.::.|.||||||||.|:. 
  Fly   195 SYCNIKFNKQ---ADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAAN 256

  Fly   248 -TSVYTDVVAFKDWIYN---------------------------TVRNFETKGDQVVYE 278
             ..|||:|...::||:|                           .:||.|...:::|||
  Fly   257 VAGVYTNVSYHREWIFNKMVQFKPTGHTTFWLSKLVGQTCNITDIIRNIELMYNRIVYE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 76/255 (30%)
Tryp_SPc 46..261 CDD:214473 73/225 (32%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 75/237 (32%)
Tryp_SPc 42..271 CDD:238113 75/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.