DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30286

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:252 Identity:77/252 - (30%)
Similarity:127/252 - (50%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AQLLDKKC--HDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQ 81
            ||.|:..|  ..|:..:|.......:| :||||.::|:.:.:|.||||:..|:||||.||.:|..
  Fly    19 AQFLEPDCGYMSPEALQNEEHQAHISE-SPWMAYLHKSGELVCGGTLVNHRFILTAAHCIREDEN 82

  Fly    82 LYVLFGMYNQY-----RDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRP 141
            |.|..|.:|..     ..:.....:|.:.:.||.:|..:...|.::|||||||...|.:..||:|
  Fly    83 LTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKP 147

  Fly   142 ICIILDHVV--KSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCA 204
            ||:|.:..:  |.....|....||.:..:||::.:.:::.:::.....|.:. ..:.....|.|.
  Fly   148 ICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKT-YWVDRRRDQICV 211

  Fly   205 GNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWI 261
            .:.....|..:||.|:........:.:.||||:||||:..|...||:|:|:...|||
  Fly   212 SHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 70/223 (31%)
Tryp_SPc 46..261 CDD:214473 68/221 (31%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 71/232 (31%)
Tryp_SPc 39..268 CDD:214473 69/230 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463418
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.