DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30098

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:279 Identity:87/279 - (31%)
Similarity:127/279 - (45%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLSLALIGLVL-CQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKL 67
            ||...|:.|.| ..|.:||||.||........|. ...|..| ||||.:.::|:|.|.|:|:...
  Fly     6 VLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIG-GQNARRT-PWMAYLIRDNRFACGGSLIAYR 68

  Fly    68 FVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSN---FRPNNGVNDIGLLRL 129
            ||||||.|...:..|:|..|.|:..|....  ....|.|....:|.|   ||.    :||.:|:|
  Fly    69 FVLTAAHCTKINDNLFVRLGEYDSSRTTDG--QTRSYRVVSIYRHKNYIDFRN----HDIAVLKL 127

  Fly   130 YGEVTHYAHIRPICIILDHVVKSA--PFERFEGFGWQQQG-------TEASSQVRQTVYLSQKKP 185
            ..:|.:.|:||||||:|:..::|.  ..:.|...||.|..       |.....:|:.        
  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRV-------- 184

  Fly   186 FECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSV 250
                || :...:.....|..|..:..|..:||.||.:...||.|.|.||.|:.:..:..|...|.
  Fly   185 ----RN-EYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS 244

  Fly   251 YTDVVAFKDWIYNT-VRNF 268
            |.|::::..|:|.| :||:
  Fly   245 YLDLMSYMPWLYQTLLRNW 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 69/229 (30%)
Tryp_SPc 46..261 CDD:214473 67/226 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 70/238 (29%)
Tryp_SPc 37..258 CDD:238113 72/241 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.