DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30090

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:283 Identity:98/283 - (34%)
Similarity:142/283 - (50%) Gaps:26/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRVLSLALIGLVLCQGLAQLLDKKCHDPKTSENINF-----NHGATETAPWMASIYKNNQFICD 60
            ::.:.:|| ||::...|..:.|:.:|  ..|:..|.|     ......:.||||.|:.:.:.||.
  Fly     5 IAAITALA-IGVLCSLGNGEYLEPRC--GLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICG 66

  Fly    61 GTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNN-------EQYGVAVALQHSNFRPN 118
            |||:.:.||||||.|:::.|.:.|..|.|:.  .|::..|:       |::.|.:|.:|..|...
  Fly    67 GTLITQRFVLTAAHCVNEGSAVKVRLGEYDD--TATEDCNSKICIPRAEEHDVDMAFRHGKFSEI 129

  Fly   119 NGVNDIGLLRLYGEVTHYAHIRPICIILD----HVVKSAPFERFEGFGWQQQGTEASSQVRQTVY 179
            ..:|||.||||...||..|||.||||||.    .:|.|  .|.|...||.:..|..:..|.|...
  Fly   130 KNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDS--IEWFVATGWGETRTHRTRGVLQITQ 192

  Fly   180 LSQKKPFECHRN-GQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSE 243
            |.:....:|.:. |:|  :.:.|.|||......|..:||.||.....:..|...||.|:|||||.
  Fly   193 LQRYNSSQCMQALGRL--VQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSR 255

  Fly   244 LCSPTSVYTDVVAFKDWIYNTVR 266
            .||...|||||.::.|||...|:
  Fly   256 ECSGIGVYTDVYSYADWIATVVQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 87/229 (38%)
Tryp_SPc 46..261 CDD:214473 85/226 (38%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 85/239 (36%)
Tryp_SPc 40..276 CDD:238113 87/241 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463446
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.