DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG30031

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:106/266 - (39%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIGLVLC-------QGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHK 66
            |:..|.|       :||...||.:......:...:|        ||..|:.::....|.|::...
  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSF--------PWQISLQRSGSHSCGGSIYSS 63

  Fly    67 LFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNN--EQYGVAVALQHSNFRPNNGVNDIGLLRL 129
            ..::|||.|:...|...:      |.|..|.::::  ..:.|:....|..:..|..||||.::::
  Fly    64 NVIVTAAHCLQSVSASVL------QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122

  Fly   130 YGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRN--G 192
            .|.:|..:.|:.|.:...:....|. ....|:|....|:.:.....|.|.::.....:|..:  |
  Fly   123 NGALTFSSTIKAIGLASSNPANGAA-ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186

  Fly   193 QLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVS--YGSELCSPTSVYTDVV 255
            ....|.....||....:..|:.:||.||.:.        .|.||:||  ||....:...||.||.
  Fly   187 YGSQIRSTMICAAASGKDACQGDSGGPLVSG--------GVLVGVVSWGYGCAYSNYPGVYADVA 243

  Fly   256 AFKDWI 261
            |.:.|:
  Fly   244 ALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 53/222 (24%)
Tryp_SPc 46..261 CDD:214473 52/220 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 53/241 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.