DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and PRSS54

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:248 Identity:55/248 - (22%)
Similarity:110/248 - (44%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPKTS--ENINFNHGATETAPWMASIYKNNQF--ICDGTLVHKLFVLTAASCISKDSQLYVLFGM 88
            |||..  .::.|        ||:.|: :::|:  :..|.::.:.:||:.||.|.....:.|:.|:
Human    42 DPKEGLVSSMEF--------PWVVSL-QDSQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGI 97

  Fly    89 YNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAH-IRPICIILDHVVKS 152
            .|.  |.|:..:.| |.|...:.|.:|..|:..|:|.||:. ....|:.: ::.|| .|..::.:
Human    98 SNM--DPSKIAHTE-YPVNTIIIHEDFDNNSMSNNIALLKT-DTAMHFGNLVQSIC-FLGRMLHT 157

  Fly   153 AP-FERFEGFGW---QQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQ--FCAGN---RD 208
            .| .:.....||   ...|...:..|.:.:::         ::..:.|:.:.|  .|..:   ..
Human   158 PPVLQNCWVSGWNPTSATGNHMTMSVLRKIFV---------KDLDMCPLYKLQKTECGSHTKEET 213

  Fly   209 RSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWI 261
            ::.|..:.|||:......  .::.|..|::::|.|.|....:||.|..:..||
Human   214 KTACLGDPGSPMMCQLQQ--FDLWVLRGVLNFGGETCPGLFLYTKVEDYSKWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 51/228 (22%)
Tryp_SPc 46..261 CDD:214473 49/226 (22%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 50/236 (21%)
Tryp_SPc 52..264 CDD:238113 50/236 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.