DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and F10

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:272 Identity:72/272 - (26%)
Similarity:118/272 - (43%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLDKKCHDPKTSENINFNH--GATE----TAPWMA-SIYKNNQFICDGTLVHKLFVLTAASCISK 78
            |||.....|:..:| |...  |..|    ..||.| .|.:.|:..|.||::.:.::||||.|:.:
Human   217 LLDFNQTQPERGDN-NLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQ 280

  Fly    79 DSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPIC 143
            ..:..|..|..|..::..   ....:.|.|.::|:.|.......||.:|||...:|...::.|.|
Human   281 AKRFKVRVGDRNTEQEEG---GEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPAC 342

  Fly   144 IILDHVVKSAPFER----FEGFGWQQQGTEASSQVR--QTVYLSQKKPFECHRNGQLLPINEGQF 202
            :......:|....:    ..|||...:....|::::  :..|:.:.   .|..:...: |.:..|
Human   343 LPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRN---SCKLSSSFI-ITQNMF 403

  Fly   203 CAG--NRDRSFCRSNSGSPLTADF--TYGVKNITVQVGLVSYGSELCS---PTSVYTDVVAFKDW 260
            |||  .:....|:.:||.|....|  ||.|      .|:||:| |.|:   ...:||.|.||..|
Human   404 CAGYDTKQEDACQGDSGGPHVTRFKDTYFV------TGIVSWG-EGCARKGKYGIYTKVTAFLKW 461

  Fly   261 IYNTVRNFETKG 272
            |   .|:.:|:|
Human   462 I---DRSMKTRG 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/231 (26%)
Tryp_SPc 46..261 CDD:214473 59/228 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 63/245 (26%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.