DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CELA1

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001962.3 Gene:CELA1 / 1990 HGNCID:3308 Length:258 Species:Homo sapiens


Alignment Length:270 Identity:71/270 - (26%)
Similarity:107/270 - (39%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PKTSENINFNHGATETA--PWMASI---YK---NNQFICDGTLVHKLFVLTAASCISKDSQLYVL 85
            |:|:..:   .|.||..  .|.:.|   |:   :....|.|||:.:.:|:|||.|:.......|:
Human    13 PETNARV---VGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVV 74

  Fly    86 FGMYNQYRDASQFFNNEQY-GVAVALQHSNFRPNN--GVNDIGLLRLYGEVTHYAHIR------- 140
            .|.:|    .||....||| .|...:.|..:..:|  ...||.||||...||..::::       
Human    75 AGDHN----LSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQE 135

  Fly   141 --------PICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTV---YLSQKKPFECHRNGQL 194
                    | |.|.               ||.:  |:.:.|:.||:   ||.......|..:...
Human   136 GAILANNSP-CYIT---------------GWGK--TKTNGQLAQTLQQAYLPSVDYAICSSSSYW 182

  Fly   195 -LPINEGQFCAGNRD-RSFCRSNSGSPL--TADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVV 255
             ..:.....|||... ||.|:.:||.||  ..:..|.|..:|..|.  |.|..:....:|:|.|.
Human   183 GSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVS--SRGCNVSRKPTVFTQVS 245

  Fly   256 AFKDWIYNTV 265
            |:..||.|.:
Human   246 AYISWINNVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/248 (26%)
Tryp_SPc 46..261 CDD:214473 63/245 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CELA1NP_001962.3 Tryp_SPc 19..254 CDD:238113 68/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.