DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and St14

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_036010597.1 Gene:St14 / 19143 MGIID:1338881 Length:875 Species:Mus musculus


Alignment Length:297 Identity:70/297 - (23%)
Similarity:116/297 - (39%) Gaps:70/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLVLCQGLAQLLDK-KCHDPKTSENINFN-HGATETA-------------PWMASIYKNNQ-FIC 59
            ||.|.:|..:...| .|.|....:|.:.. ...|:.|             ||..|::...| .:|
Mouse   597 GLCLSKGNPECDGKTDCSDGSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLC 661

  Fly    60 DGTLVHKLFVLTAASCISKDSQL----YVLF----GMYNQ-YRDASQFFNNEQYGVAVALQHSNF 115
            ..:|:...::::||.|...|...    |.::    |:.:| .|.||   ..::..:...:.|.:|
Mouse   662 GASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSAS---GVQELKLKRIITHPSF 723

  Fly   116 RPNNGVNDIGLLRLYGEVTHYAHIRPICI-ILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVY 179
            .......||.||.|...|.:...:||||: ...||..:.......|:|..::|...:       .
Mouse   724 NDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGA-------L 781

  Fly   180 LSQKKPFECHRNGQLLPINEGQ-----------------FCAGNRDRSFCRSNSGSPLTADFTYG 227
            :.||        |::..||:..                 |.:|..|.  |:.:||.||::....|
Mouse   782 ILQK--------GEIRVINQTTCEDLMPQQITPRMMCVGFLSGGVDS--CQGDSGGPLSSAEKDG 836

  Fly   228 VKNITVQVGLVSYGSELCSPTS---VYTDVVAFKDWI 261
               ...|.|:||:| |.|:..:   |||.:...:|||
Mouse   837 ---RMFQAGVVSWG-EGCAQRNKPGVYTRLPVVRDWI 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/247 (24%)
Tryp_SPc 46..261 CDD:214473 58/245 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
St14XP_036010597.1 SEA 108..198 CDD:396113
CUB 247..352 CDD:238001
CUB 360..464 CDD:238001
LDLa 474..506 CDD:238060
LDLa 512..543 CDD:238060
LDLa 545..579 CDD:238060
LDLa 587..622 CDD:238060 7/24 (29%)
Tryp_SPc 635..872 CDD:238113 60/259 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.