DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and T22A3.6

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:322 Identity:60/322 - (18%)
Similarity:91/322 - (28%) Gaps:145/322 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRVLSL-ALIGLV---------------LCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMA 49
            ||.:|.| .|||:.               |..|:.:|..|.|        ||..|.|....||:|
 Worm   197 MSDILDLPQLIGIFKDVDLMYESRFVLPSLPDGVQRLSTKSC--------INKGHIANHFGPWIA 253

  Fly    50 SIYKN-NQF-----------ICDGTL-VHKLFV--------------LTAASC------------ 75
            .:.:. .||           :|..:. .|::|.              ||.:.|            
 Worm   254 VLDQTATQFLAAAGRRKLRDLCFPSFNEHEIFTYQQGILLDAIIEDELTISGCTFWRRCFSSCQD 318

  Fly    76 ---------------------------------------ISKDSQLYVLFGMYNQ--YRDASQFF 99
                                                   :..:|....::.||::  :.|.||||
 Worm   319 DLATCWLKSQKGYFGSKATSVSGKQCIPWTQATSEILSMVKVNSTSSGVYHMYHRLLFEDPSQFF 383

  Fly   100 N---------------NEQYGVAV--ALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILD 147
            .               |.:..|.|  :.:.|.|..|.        :|..|........|.|.:..
 Worm   384 TESRLFMNTEASCMLLNRRNSVEVKNSYKESPFFTNE--------KLVSEFEKLFQQGPGCFVKQ 440

  Fly   148 HVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKP--FECHRNGQLLPINEGQFCAGNR 207
            :  |:..|        |...||..|:.:.|:    .||  ||.:|.....|...|.:....|
 Worm   441 N--KTIEF--------QSCYTECESEKKPTL----TKPLCFEKNRYSICKPKRSGDWLKRGR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 44/261 (17%)
Tryp_SPc 46..261 CDD:214473 44/261 (17%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.