Sequence 1: | NP_001033950.2 | Gene: | CG33465 / 3885587 | FlyBaseID: | FBgn0053465 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492773.3 | Gene: | T22A3.6 / 188711 | WormBaseID: | WBGene00011909 | Length: | 491 | Species: | Caenorhabditis elegans |
Alignment Length: | 322 | Identity: | 60/322 - (18%) |
---|---|---|---|
Similarity: | 91/322 - (28%) | Gaps: | 145/322 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSRVLSL-ALIGLV---------------LCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMA 49
Fly 50 SIYKN-NQF-----------ICDGTL-VHKLFV--------------LTAASC------------ 75
Fly 76 ---------------------------------------ISKDSQLYVLFGMYNQ--YRDASQFF 99
Fly 100 N---------------NEQYGVAV--ALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILD 147
Fly 148 HVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKP--FECHRNGQLLPINEGQFCAGNR 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33465 | NP_001033950.2 | Tryp_SPc | 46..264 | CDD:238113 | 44/261 (17%) |
Tryp_SPc | 46..261 | CDD:214473 | 44/261 (17%) | ||
Tryp_SPc | 293..484 | CDD:304450 | |||
Tryp_SPc | 293..481 | CDD:214473 | |||
T22A3.6 | NP_492773.3 | KR | 98..173 | CDD:350900 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |